PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003578P3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 765aa    MW: 84992.9 Da    PI: 5.443
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003578P3genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.3e-181965148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av  + g++Wk+Ia ++   Rt+ qc +rwqk+l
   MELO3C003578P3 19 KGQWTPEEDEILRQAVDHFKGKNWKKIAGYFK-DRTDVQCLHRWQKVL 65
                     799****************************9.************986 PP

2Myb_DNA-binding65.97.4e-2171117148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde+++d+v+++G++ W+tIa +++ gR +kqc++rw+++l
   MELO3C003578P3  71 KGPWSKEEDEIIIDLVNKYGPKKWSTIATHLP-GRIGKQCRERWHNHL 117
                      79******************************.*************97 PP

3Myb_DNA-binding49.11.3e-15123165145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
   MELO3C003578P3 123 KEAWTQEEELALIRAHQIYGNR-WAELTKFLP-GRTDNAIKNHWN 165
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9641465IPR017930Myb domain
SMARTSM007171.9E-141867IPR001005SANT/Myb domain
PfamPF002498.3E-161965IPR001005SANT/Myb domain
SuperFamilySSF466892.23E-152075IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-252177IPR009057Homeodomain-like
CDDcd001674.53E-132265No hitNo description
PROSITE profilePS5129433.36166121IPR017930Myb domain
SuperFamilySSF466891.83E-3168164IPR009057Homeodomain-like
SMARTSM007172.4E-1970119IPR001005SANT/Myb domain
PfamPF002497.2E-1971117IPR001005SANT/Myb domain
CDDcd001674.09E-1773117No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2878120IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-22121172IPR009057Homeodomain-like
PROSITE profilePS5129419.563122172IPR017930Myb domain
SMARTSM007172.2E-15122170IPR001005SANT/Myb domain
PfamPF002491.2E-13123166IPR001005SANT/Myb domain
CDDcd001673.08E-12125165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MFFSGVFRRT SGPTRRSTKG QWTPEEDEIL RQAVDHFKGK NWKKIAGYFK DRTDVQCLHR  60
WQKVLNPELV KGPWSKEEDE IIIDLVNKYG PKKWSTIATH LPGRIGKQCR ERWHNHLNPN  120
INKEAWTQEE ELALIRAHQI YGNRWAELTK FLPGRTDNAI KNHWNSSVKK KLDSYLASGL  180
LSQFQDPVPA GQPNQLPVSS SKVLGGRNDS GLKGMDTEEI SECSQDAKIS DSLMIDSACA  240
TLNIRKEFRL TKDLGLGKEQ SASPVSNSEP YYRPPMEVIT CPIAEFAQEM GHLSHSQQNL  300
SHDCRTTSNR EHQCDLNEFP SISSLQVAKE ASQFQSMDHG MGESHGIGDS VQTSLTVKGA  360
VTSAQAECMF ISDDECCRVL FSDTKSDRGH LTSNLKGPCV TEMCDYEVPV RSLGTPKVEN  420
NHTLTSQYNH PSGADVQEKN SFGQSRMLIP SMVSVNGDMI LLGDTGSNLF VGAVEHECVT  480
SQQNRFVYKD GTSKPSYFDV ADNPEMQEQP GGSEDLPKPI CENTFATAAA AAEADGTGTC  540
TRLDGTAKQN DKHQDSRALC YEPPRFPSLD VPFFSCDLIQ SGSEMQEYSP LGIRQLMMSS  600
LNSVTPFRLW DSPSHDTSPD AVLKSAAKTF ASTPSILKKR HRDLMSPLSE RRTDKKLETD  660
VTSSLTENFS RLDVVFDNGS VKASILSPSN LKKSIEDPAE DKENMHCTFE DSNESLDVMI  720
PENGFPKSCS QDYTKQGTAD TEMISVQSTS EIVSHFSTNF LVDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-71191726159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-71191726159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466237.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_008466238.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A0A0LHI70.0A0A0A0LHI7_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.10.0Homeodomain-like protein